SARSCoV2

Vaccine and prior SARS-CoV-2 infection provide long-lasting protection against omicron BA.5

Vaccine and prior SARS-CoV-2 infection provide long-lasting protection against omicron BA.5

Illustration of SARS-CoV-2. Credit: Helena Pinheiro, iMM A new study led by Luís Graça, group leader at the Instituto de Medicina Molecular João Lobo Antunes (iMM, Lisbon) and full professor at the Faculty of Medicine of the University of Lisbon, and Manuel Carmo Gomes, associate professor with aggregation at the Faculty of Sciences of the …

Vaccine and prior SARS-CoV-2 infection provide long-lasting protection against omicron BA.5 Read More »

Intratracheal administration of a cocktail of trimerized nanobodies suppresses weight loss and prolongs survival in mice infected with SARS-CoV-2 – Communications Medicine

Production and trimerization of nanobodies Nanobodies targeting SARS-CoV-2 spike protein were selected as previously described12.13. N-terminal labeled tandem homotrimer PelB (MKYLLPTAAAGLLLLAAQPAMA) genes of the two-connected nanobody (GGGGS)4 linkers and 6 x C-terminal His-tag were synthesized and subcloned into the pMES4 vector. The exact amino acid sequences are as follows: TP17, MKYLLPTAAAGLLLLAAQPAMAQVQLQESGGGLVQAGGSLRLSCAASGRTSSVYNMAWFRQTPGKEREFVAAITGNGGTTLYADSVKGRLTISRGNAKNTVSLQMNVLKPDDTAVYYCAAGGWGKERNYAYWGQGTQVTVSSGGGGSGGGGSGGGGSGGGGSQVQLQESGGGLVQAGGSLRLSCAASGRTSSVYNMAWFRQTPGKEREFVAAITGNGGTTLYADSVKGRLTISRGNAKNTVSLQMNVLKPDDTAVYYCAAGGWGKERNYAYWGQGTQVTVSSGGGGSGGGGSGGGGSGGGGSQVQLQESGGGLVQAGGSLRLSCAASGRTSSVYNMAWFRQTPGKEREFVAAITGNGGTTLYADSVKGRLTISRGNAKNTVSLQMNVLKPDDTAVYYCAAGGWGKERNYAYWGQGTQVTVSSHHHHHH; TP86, MKYLLPTAAAGLLLLAAQPAMAMAQVQLQESGGGLVQAGGSLRLSCVASGRTFSSLNIVWFRQAPGKERKFVAAINDRNTAYAESVKGRFTISRDNAKNTVHLQMNSLKPEDTAVYYCHSADVNGGMDYWGKGTQVTVSSGGGGSGGGGSGGGGSGGGGSQVQLQESGGGLVQAGGSLRLSCVASGRTFSSLNIVWFRQAPGKERKFVAAINDRNTAYAESVKGRFTISRDNAKNTVHLQMNSLKPEDTAVYYCHSADVNGGMDYWGKGTQVTVSSGGGGSGGGGSGGGGSGGGGSQVQLQESGGGLVQAGGSLRLSCVASGRTFSSLNIVWFRQAPGKERKFVAAINDRNTAYAESVKGRFTISRDNAKNTVHLQMNSLKPEDTAVYYCHSADVNGGMDYWGKGTQVTVSSHHHHHH. These expression …

Intratracheal administration of a cocktail of trimerized nanobodies suppresses weight loss and prolongs survival in mice infected with SARS-CoV-2 – Communications Medicine Read More »

Small study links prior SARS-CoV-2 infection to coronary vasomotor dysfunction

October 31, 2022 2 minute read Source/Disclosures Published by: Disclosures: The authors report no relevant financial information. ADD A SUBJECT TO EMAIL ALERTS Receive an email when new articles are published on Please provide your email address to receive an email when new articles are published on . ” data-action=subscribe> Subscribe We have not been …

Small study links prior SARS-CoV-2 infection to coronary vasomotor dysfunction Read More »